PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21713A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25664.6 Da    PI: 10.1848
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21713AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.8e-30959151
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                               krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gk+ye++s
  Oropetium_20150105_21713A  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKVYEFAS 59
                               79***********************************************86 PP

2K-box69.11.4e-2379171698
                      K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                                ++++ +++ ++ + ++  L  +ie L++++R++lGe+Le++s++eL +Le +Leksl  iR kK+ell +qi +l++ke++l +
  Oropetium_20150105_21713A  79 NNKTVQKDIQQVKSDALSLATKIEALEKSKRKFLGESLEQCSIEELYSLEVKLEKSLHIIRGKKTELLEQQIAKLKEKERNLVN 162
                                4456778899************************************************************************** PP

                      K-box  90 enkaLrkkl 98 
                                +nk+Lr+k 
  Oropetium_20150105_21713A 163 KNKELREKQ 171
                                ******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-31381IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-30323IPR002100Transcription factor, MADS-box
CDDcd002652.88E-39375No hitNo description
PfamPF003194.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.01387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVRRKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKVYEFASA  60
ASIQKTIDRY KTYTKEMVNN KTVQKDIQQV KSDALSLATK IEALEKSKRK FLGESLEQCS  120
IEELYSLEVK LEKSLHIIRG KKTELLEQQI AKLKEKERNL VNKNKELREK QHNLQAHLAV  180
PALKNCIQPP QLRDVPTPSN DNADVVTELY IGLPGSERPS NRDSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-17373271Myocyte-specific enhancer factor 2A
3mu6_C4e-17373271Myocyte-specific enhancer factor 2A
3mu6_B4e-17373271Myocyte-specific enhancer factor 2A
3mu6_A4e-17373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-127PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-105MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLA0A0C4MKI01e-124A0A0C4MKI0_9POAL; Uncharacterized protein
STRINGSb01g030570.11e-122(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-69AGAMOUS-like 19